PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC02G26700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 288aa    MW: 31466.6 Da    PI: 8.9696
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC02G26700.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1071e-333185155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     kprlrWtp+LHerFveav++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  OPUNC02G26700.1 31 KPRLRWTPDLHERFVEAVTKLGGPDKATPKSVLRLMGMKGLTLYHLKSHLQKYRL 85
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.0322888IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.7E-332886IPR009057Homeodomain-like
SuperFamilySSF466891.0E-163188IPR009057Homeodomain-like
TIGRFAMsTIGR015579.3E-253186IPR006447Myb domain, plants
PfamPF002499.0E-103384IPR001005SANT/Myb domain
PfamPF143791.1E-24130174IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MFEGMERAGY GVGVGGAGAV GAGVVLSRDP KPRLRWTPDL HERFVEAVTK LGGPDKATPK  60
SVLRLMGMKG LTLYHLKSHL QKYRLGKQNK KDTGLEASRG AFAAHGISFA SAAPPTIPSA  120
ENNNAGETPL ADALRYQIEV QRKLHEQLEV QKKLQMRIEA QGKYLQTILE KAQNNLTYDA  180
TGTANLEATR TQLTDFNLAL SGFMNNVSQV CEQNNGELAK AISEDNLRTT NLGFQLYHGI  240
QESDDVKCSQ DEGLLLLDLN IKGGGYDHMS SNTMRGGESG LKISQHRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0594480.0AK059448.1 Oryza sativa Japonica Group cDNA clone:001-028-A10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623757.10.0PREDICTED: myb family transcription factor APL
SwissprotQ9SAK52e-51APL_ARATH; Myb family transcription factor APL
TrEMBLA0A0E0K4040.0A0A0E0K404_ORYPU; Uncharacterized protein
STRINGLOC_Os02g47190.10.0(Oryza sativa Japonica Group)
STRINGORGLA02G0249400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39403470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.17e-65G2-like family protein